Web stats for Allucansurf - allucansurf.de
Erfahrungsberichte Testberichte Fotos Bilder
1.67 Rating by ClearWebStats
This website has a #1,476,710 rank in global traffic. It has a .de as an domain extension. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. Additionally, the website is monetizing using Adsense. While no active threats were reported recently by users, allucansurf.de is SAFE to browse.
Traffic Report of Allucansurf
Daily Unique Visitors: | 326 |
Daily Pageviews: | 652 |
Estimated Valuation
Income Per Day: | $ 2.00 |
Estimated Worth: | $ 480.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Good |
WOT Privacy: | Good |
WOT Child Safety: | Good |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 1,476,710 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
69
Siteadvisor Rating
Not Applicable
Where is allucansurf.de server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 11 | H2 Headings: | 1 |
H3 Headings: | 1 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 8 |
Google Adsense: | pub-6503066897086707 | Google Analytics: | UA-25162727-1 |
Websites Hosted on Same IP (i.e. 46.38.249.68)
JumpSport Fitnesstrampoline | Abheben und Abnehmen mit dem JumpSport Fitnesstrampolin
- jumpsportfitness.de
devops blog | daily devops problems solved and explained
- devops-blog.net
This Blog is about the daily problems that devops will face. Topics that cost us hours to solve. We will share these findings with you in their essence.
Haus am Strom
- hausamstrom.de
Haus am Strom in Jochenstein. Umweltbildungsstation im Passauer Donautal. Umweltbildung für Kinder und Erwachsenen. Naturschutz, Beratung und Vermittlung.
WireSys - Wir bringen Sie ins Netz!
- wiresys.de
Webhosting, Domains, Server, Management und Web-Development - Leistung, die einfach überzeugt!
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 07 Jan 2017 01:56:18 GMT
Server: Apache
Link: ; rel="https://api.w.org/"
Content-Encoding: gzip
Vary: Accept-Encoding,Cookie,User-Agent
Content-Length: 15400
Connection: close
Content-Type: text/html; charset=UTF-8
Status-Code: 200
Status: 200 OK
Date: Sat, 07 Jan 2017 01:56:18 GMT
Server: Apache
Link:
Content-Encoding: gzip
Vary: Accept-Encoding,Cookie,User-Agent
Content-Length: 15400
Connection: close
Content-Type: text/html; charset=UTF-8
Domain Information for allucansurf.de
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
allucansurf.de | A | 7200 |
IP:46.38.249.68 |
allucansurf.de | NS | 7200 |
Target:third-dns.netcup.net |
allucansurf.de | NS | 7200 |
Target:second-dns.netcup.net |
allucansurf.de | NS | 7200 |
Target:root-dns.netcup.net |
allucansurf.de | SOA | 7200 |
MNAME:root-dns.netcup.net RNAME:dnsadmin.netcup.net Serial:2016021808 Refresh:28800 Retry:7200 Expire:1209600 |
allucansurf.de | MX | 7200 |
Priority:5 Target:mxf948.netcup.net |
allucansurf.de | MX | 7200 |
Priority:10 Target:mail.allucansurf.de |
allucansurf.de | TXT | 7200 |
TXT:v=spf1 mx a |
Similarly Ranked Websites to Allucansurf
شركة كشف تسربات المياه بالرياض (الموقع للايجار
- companydetectleakswaterinriyadh.com
شركات كشف تسربات بالرياض بأحدث وسائل مع الإصلاح بالضمان,وإصلاح تسربات المياه كشف تسربات المياه فى الرياض بدون تكسير باحدث اجهزة في كشف تسرب الماء في الجدار من
Full WHOIS Lookup for allucansurf.de
% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
Domain: allucansurf.de
Nserver: root-dns.netcup.net
Nserver: second-dns.netcup.net
Nserver: third-dns.netcup.net
Status: connect
Changed: 2012-11-12T13:49:09+01:00
[Tech-C]
Type: PERSON
Name: Felix Preuß
Organisation: netcup GmbH
Address: Daimlerstr. 25
PostalCode: 76185
City: Karlsruhe
CountryCode: DE
Phone: +49 721 75407550
Fax: +49 721 75407559
Email: [email protected]
Changed: 2013-03-28T13:48:26+01:00
[Zone-C]
Type: PERSON
Name: Felix Preuß
Organisation: netcup GmbH
Address: Daimlerstr. 25
PostalCode: 76185
City: Karlsruhe
CountryCode: DE
Phone: +4972175407550
Fax: +4972175407559
Email: [email protected]
Changed: 2013-03-28T14:09:08+01:00
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
Domain: allucansurf.de
Nserver: root-dns.netcup.net
Nserver: second-dns.netcup.net
Nserver: third-dns.netcup.net
Status: connect
Changed: 2012-11-12T13:49:09+01:00
[Tech-C]
Type: PERSON
Name: Felix Preuß
Organisation: netcup GmbH
Address: Daimlerstr. 25
PostalCode: 76185
City: Karlsruhe
CountryCode: DE
Phone: +49 721 75407550
Fax: +49 721 75407559
Email: [email protected]
Changed: 2013-03-28T13:48:26+01:00
[Zone-C]
Type: PERSON
Name: Felix Preuß
Organisation: netcup GmbH
Address: Daimlerstr. 25
PostalCode: 76185
City: Karlsruhe
CountryCode: DE
Phone: +4972175407550
Fax: +4972175407559
Email: [email protected]
Changed: 2013-03-28T14:09:08+01:00